A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10743
Swiss-prot Accession number	P20391 (Sequence in FASTA format)
Description	Somatotropin (Growth hormone).
Source organism	Katsuwonus pelamis (Skipjack tuna) (Bonito)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Katsuwonus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	185 Amino acids
Molecular weight	21235
References	1  PubMed abstract 3246482
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	QPITESQRLFSIAVSRVQNLHLLAQRLFSDFESSLQTQEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGAQRNQISEKLSDLKMGIQLLIRANQDGAEMFADSSALQLAPYGNYYQSLGGDESLRRNYELLACFKKDMHKVETYLMVAKCRLSPEANCTL
Position of mature hormone in Pre-Hormone protein	185 Residues from position (1-185)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10846
Swiss-prot Accession number	P01340 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Katsuwonus pelamis (Skipjack tuna) (Bonito)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Katsuwonus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5698
References	1  PubMed abstract 14035061 2  PubMed abstract 14036898
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANPHLCGSHLVEALYLVCGERGFFYQPK
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	2G56
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10847
Swiss-prot Accession number	P01340 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Katsuwonus pelamis (Skipjack tuna) (Bonito)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Katsuwonus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5698
References	1  PubMed abstract 14035061 2  PubMed abstract 14036898
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIHZZCCHKPCBIFZLZBYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (30-50)
Receptor	N/A
Gene ID	N/A
PDB ID	2G56
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated